PDB entry 6e65

View 6e65 on RCSB PDB site
Description: Crystal structure of malaria transmission-blocking antigen Pfs48/45 6C in complex with antibody 85RF45.1
Class: immune system
Keywords: malaria, transmission-blocking, antibody, IMMUNE SYSTEM
Deposited on 2018-07-23, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: TB31F Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E65 (0-End)
  • Chain 'L':
    Compound: TB31F Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E65 (0-End)
    Domains in SCOPe 2.07: d6e65l1, d6e65l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6e65L (L:)
    nfmltqphsvsespgktvtisctrstgnigsnyvswyqqrpgsspttviyrddqrpsgvp
    drfsgsidrssnsasltisglktedeadyychsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e65L (L:)
    nfmltqphsvsespgktvtisctrstgnigsnyvswyqqrpgsspttviyrddqrpsgvp
    drfsgsidrssnsasltisglktedeadyychsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapte