PDB entry 6e62

View 6e62 on RCSB PDB site
Description: Crystal structure of malaria transmission-blocking antigen Pfs48/45 6C in complex with antibody 85RF45.1
Class: immune system
Keywords: malaria, transmission-blocking, antigen, antibody, IMMUNE SYSTEM
Deposited on 2018-07-23, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pf48/45
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8QVT1 (Start-137)
      • expression tag (138)
  • Chain 'B':
    Compound: 85RF45.1 Fab heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E62 (0-End)
  • Chain 'C':
    Compound: 85RF45.1 Fab light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E62 (0-End)
    Domains in SCOPe 2.07: d6e62c1, d6e62c2
  • Chain 'H':
    Compound: 85RF45.1 Fab heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E62 (0-End)
  • Chain 'L':
    Compound: 85RF45.1 Fab light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E62 (0-End)
    Domains in SCOPe 2.07: d6e62l1, d6e62l2
  • Chain 'P':
    Compound: Pf48/45
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8QVT1 (Start-137)
      • expression tag (138)
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e62C (C:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e62C (C:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6e62L (L:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e62L (L:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'P':
    No sequence available.