PDB entry 6e5l

View 6e5l on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 1 in complex with abnormal-cannabidiol (abn-CBD)
Class: lipid binding protein
Keywords: vitamin A, retinol, abn-CBD, abnormal cannabidiol, LIPID BINDING PROTEIN
Deposited on 2018-07-20, released 2019-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP1, CRBP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09455 (0-133)
    • expression tag (134-139)
  Domains in SCOPe 2.08: d6e5la1, d6e5la2
• Heterogens: HVD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6e5lA (A:)
  pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
  imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
  vegvvckqvfkkvqhhhhhh