PDB entry 6e4b

View 6e4b on RCSB PDB site
Description: The crystal structure of a putative alpha-ribazole-5'-P phosphatase from Escherichia coli str. K-12 substr. MG1655
Class: hydrolase
Keywords: alpha-ribazole-5'-P phosphatase, Center For Structural Genomics Of Infectious Diseases (CSGID), HYDROLASE
Deposited on 2018-07-17, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylcobalamin/alpha-ribazole phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cobC, phpB, b0638, JW0633
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52086 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d6e4ba1, d6e4ba2
  • Chain 'B':
    Compound: Adenosylcobalamin/alpha-ribazole phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cobC, phpB, b0638, JW0633
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52086 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d6e4bb1, d6e4bb2
  • Chain 'C':
    Compound: Adenosylcobalamin/alpha-ribazole phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cobC, phpB, b0638, JW0633
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52086 (24-End)
      • expression tag (22-23)
    Domains in SCOPe 2.07: d6e4bc1, d6e4bc2
  • Chain 'D':
    Compound: Adenosylcobalamin/alpha-ribazole phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cobC, phpB, b0638, JW0633
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52086 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d6e4bd1, d6e4bd2
  • Heterogens: CL, 1PE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e4bA (A:)
    mhhhhhhssgvdlgtenlyfqsnamrlwlirhgetqanidglysghaptpltargieqaq
    nlhtllhgvsfdlvlcseleraqhtarlvlsdrqlpvqiipelnemffgdwemrhhrdlm
    qedaenysawcndwqhaiptngegfqafsqrverfiarlsefqhyqnilvvshqgvlsll
    iarligmpaeamwhfrvdqgcwsaidinqkfatlrvlnsraigvena
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4bA (A:)
    amrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraq
    htarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptnge
    gfqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcws
    aidinqkfatlrvlnsraigven
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e4bB (B:)
    mhhhhhhssgvdlgtenlyfqsnamrlwlirhgetqanidglysghaptpltargieqaq
    nlhtllhgvsfdlvlcseleraqhtarlvlsdrqlpvqiipelnemffgdwemrhhrdlm
    qedaenysawcndwqhaiptngegfqafsqrverfiarlsefqhyqnilvvshqgvlsll
    iarligmpaeamwhfrvdqgcwsaidinqkfatlrvlnsraigvena
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4bB (B:)
    amrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraq
    htarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptnge
    gfqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcws
    aidinqkfatlrvlnsraigven
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e4bC (C:)
    mhhhhhhssgvdlgtenlyfqsnamrlwlirhgetqanidglysghaptpltargieqaq
    nlhtllhgvsfdlvlcseleraqhtarlvlsdrqlpvqiipelnemffgdwemrhhrdlm
    qedaenysawcndwqhaiptngegfqafsqrverfiarlsefqhyqnilvvshqgvlsll
    iarligmpaeamwhfrvdqgcwsaidinqkfatlrvlnsraigvena
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4bC (C:)
    namrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcselera
    qhtarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptng
    egfqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcw
    saidinqkfatlrvlnsraigve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e4bD (D:)
    mhhhhhhssgvdlgtenlyfqsnamrlwlirhgetqanidglysghaptpltargieqaq
    nlhtllhgvsfdlvlcseleraqhtarlvlsdrqlpvqiipelnemffgdwemrhhrdlm
    qedaenysawcndwqhaiptngegfqafsqrverfiarlsefqhyqnilvvshqgvlsll
    iarligmpaeamwhfrvdqgcwsaidinqkfatlrvlnsraigvena
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4bD (D:)
    amrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraq
    htarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqptngegfq
    afsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsaid
    inqkfatlrvlnsraigv