PDB entry 6e47

View 6e47 on RCSB PDB site
Description: Crystal Structure of the Murine Norovirus VP1 P domain in complex with the CD300lf Receptor and Glycochenodeoxycholic Acid
Class: viral protein
Keywords: Norovirus, Capsid protein, Protruding domain, bile acid, VIRAL PROTEIN, GCDCA, myeloid receptor, CMRF-35-like molecule-1, CLM-1, CLM1, DIR2, IREM1, LMIR3, PIGR3, IgSF13
Deposited on 2018-07-16, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VP1 P domain
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: VP1 P domain
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: CD300lf, CLM1, DIR2, IREM1, LMIR3, PIGR3, IgSF13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e47f_
  • Chain 'G':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: CD300lf, CLM1, DIR2, IREM1, LMIR3, PIGR3, IgSF13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e47g_
  • Heterogens: CHO, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e47F (F:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e47F (F:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e47G (G:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt