PDB entry 6e3b

View 6e3b on RCSB PDB site
Description: STRUCTURE OF Siw14 CATALYTIC CORE
Class: hydrolase
Keywords: dual specificity phosphatase, inositol phosphate, VH1-like phosphatase, HYDROLASE
Deposited on 2018-07-13, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3ba_
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bb_
  • Chain 'C':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bc_
  • Chain 'D':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bd_
  • Chain 'E':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3be_
  • Chain 'F':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bf_
  • Chain 'G':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bg_
  • Chain 'H':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bh_
  • Chain 'I':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bi_
  • Chain 'J':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bj_
  • Chain 'K':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bk_
  • Chain 'L':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bl_
  • Chain 'M':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bm_
  • Chain 'N':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bn_
  • Chain 'O':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bo_
  • Chain 'P':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bp_
  • Chain 'Q':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bq_
  • Chain 'R':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3br_
  • Chain 'S':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bs_
  • Chain 'T':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bt_
  • Chain 'V':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bv_
  • Chain 'W':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bw_
  • Chain 'X':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3bx_
  • Chain 'Y':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIW14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (0-168)
      • conflict (101)
    Domains in SCOPe 2.07: d6e3by_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bA (A:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bB (B:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bC (C:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bD (D:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bE (E:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bF (F:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bG (G:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bH (H:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bI (I:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bJ (J:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bK (K:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bL (L:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bM (M:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bN (N:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bO (O:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bP (P:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bQ (Q:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bR (R:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bS (S:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6e3bT (T:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e3bT (T:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvipeeypqenlnflkltgi
    klyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklqn
    wsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bV (V:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bW (W:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bX (X:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3bY (Y:)
    nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
    nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw