PDB entry 6dzn

View 6dzn on RCSB PDB site
Description: Pan-ebolavirus human antibody ADI-15878 Fab
Class: immune system
Keywords: ADI-15878, Antibody, pan-ebolavirus, immunotherapeutic, Ebola virus, Bundibugyo virus, IMMUNE SYSTEM
Deposited on 2018-07-05, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody ADI-15878, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DZN (0-225)
  • Chain 'L':
    Compound: Antibody ADI-15878, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DZN (0-212)
    Domains in SCOPe 2.07: d6dznl1, d6dznl2
  • Heterogens: CL, AE3, PG4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dznL (L:)
    divltqspstlsasvgdrvtitcrasqsisswlawyqqkpgeapkllisdasslesgvps
    rfsgsgsgteftltisslqpddfatyycqqyysspifgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgec