PDB entry 6dz8

View 6dz8 on RCSB PDB site
Description: Crystal structure of S. aureus penicillin binding protein 4 (PBP4) mutant (S75C)
Class: hydrolase
Keywords: Hydrolase, Penicillin binding protein
Deposited on 2018-07-03, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: pbp4, SACOL0699
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H2WY27 (0-358)
      • engineered mutation (50)
    Domains in SCOPe 2.07: d6dz8a1, d6dz8a2
  • Chain 'B':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: pbp4, SACOL0699
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H2WY27 (0-358)
      • engineered mutation (50)
    Domains in SCOPe 2.07: d6dz8b1, d6dz8b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dz8A (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpacmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dz8B (B:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpacmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq