PDB entry 6dxs

View 6dxs on RCSB PDB site
Description: Crystal structure of the LigJ hydratase E284Q mutant substrate complex with (3Z)-2-keto-4-carboxy-3-hexenedioate
Class: lyase/lyase inhibitor
Keywords: Hydratase, amidohydrolase, LYASE, lyase-lyase inhibitor complex
Deposited on 2018-06-29, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2IQQ5 (0-339)
      • engineered mutation (282)
      • expression tag (340-341)
    Domains in SCOPe 2.07: d6dxsa1, d6dxsa2
  • Chain 'B':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2IQQ5 (0-339)
      • engineered mutation (282)
      • expression tag (340-341)
    Domains in SCOPe 2.07: d6dxsb1, d6dxsb2
  • Chain 'C':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2IQQ5 (0-339)
      • engineered mutation (282)
      • expression tag (340-341)
    Domains in SCOPe 2.07: d6dxsc1, d6dxsc2
  • Chain 'D':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2IQQ5 (0-339)
      • engineered mutation (282)
      • expression tag (340-341)
    Domains in SCOPe 2.07: d6dxsd1, d6dxsd2
  • Heterogens: ZN, HJ7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dxsA (A:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsqmvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkarglle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dxsB (B:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsqmvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkarglle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dxsC (C:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsqmvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkarglle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dxsD (D:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsqmvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkarglle