PDB entry 6dxq

View 6dxq on RCSB PDB site
Description: Crystal structure of the LigJ Hydratase product complex with 4-carboxy-4-hydroxy-2-oxoadipate
Class: lyase
Keywords: Hydratase, lignin degradation, LYASE
Deposited on 2018-06-29, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxqa_
  • Chain 'B':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxqb_
  • Chain 'C':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxqc_
  • Chain 'D':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxqd_
  • Heterogens: 7QD, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxqA (A:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxqA (A:)
    iidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerga
    dmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmts
    siaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgsc
    npamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladmlk
    qpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfddt
    kryidaldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxqB (B:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxqB (B:)
    mmiidchghytvlpkahdewreqqkaafkapappypeisddeiretieanqlrlikerga
    dmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmts
    siaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgsc
    npamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladmlk
    qpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfddt
    kryidaldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dxqC (C:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxqC (C:)
    mmiidchghytvlpkahdewreqqkaafkaypeisddeiretieanqlrlikergadmti
    fsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmtssiae
    lercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgscnpam
    hatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladmlkqpsl
    dtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfddtkryi
    daldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dxqD (D:)
    mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
    gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
    tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
    scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
    lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfd
    dtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxqD (D:)
    miidchghytvlpkahdewreqqkaafkppypeiseiretieanqlrlikergadmtifs
    prasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmtssiaele
    rcvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgscnpamha
    tgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladmlkqpsldt
    llmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfddtkryida
    ldisdqerhaifegntrrvfprldaklkargl