PDB entry 6dxk

View 6dxk on RCSB PDB site
Description: Glucocorticoid Receptor in complex with Compound 11
Class: transcription
Keywords: signaling protein, nuclear hormone receptor, ligand complex, transcription
Deposited on 2018-06-29, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • variant (15)
      • variant (18)
      • variant (82)
      • variant (118)
      • variant (164)
      • variant (168)
      • variant (192)
    Domains in SCOPe 2.07: d6dxka_
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150 (Start-257)
      • variant (15)
      • variant (18)
      • variant (82)
      • variant (118)
      • variant (164)
      • variant (168)
      • variant (192)
    Domains in SCOPe 2.07: d6dxkb_
  • Heterogens: HJ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxkA (A:)
    sspatspqstptlvsaletiepevlyagydssvpdstwrimttlnmlggrqviaavkwak
    aipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpdm
    ydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgk
    aivkregnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitn
    qipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxkA (A:)
    ptlvsaletiepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnlhl
    ddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
    sselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregnss
    qnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
    kkllfhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxkB (B:)
    sspatspqstptlvsaletiepevlyagydssvpdstwrimttlnmlggrqviaavkwak
    aipgfrnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpdm
    ydqckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgk
    aivkregnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitn
    qipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxkB (B:)
    ptlvsaletiepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnlhl
    ddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
    sselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregnss
    qnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
    kkllfhqk