PDB entry 6dxe

View 6dxe on RCSB PDB site
Description: Crystal structure of chalcone synthase from Arabidopsis thaliana - M64I F170S G173A S213G Q217A T270V C347S mutant
Class: transferase
Keywords: Thiolase, Flavonoid, Polyketide synthase, TRANSFERASE
Deposited on 2018-06-28, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13114 (Start-394)
      • engineered mutation (63)
      • engineered mutation (169)
      • engineered mutation (172)
      • engineered mutation (212)
      • engineered mutation (216)
      • engineered mutation (269)
      • engineered mutation (346)
    Domains in SCOPe 2.07: d6dxea1, d6dxea2
  • Chain 'C':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13114 (Start-394)
      • engineered mutation (63)
      • engineered mutation (169)
      • engineered mutation (172)
      • engineered mutation (212)
      • engineered mutation (216)
      • engineered mutation (269)
      • engineered mutation (346)
    Domains in SCOPe 2.07: d6dxec1, d6dxec2
  • Heterogens: CSO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxeA (A:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkricdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcsagatvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldglvgaalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevglvfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssasvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxeA (A:)
    ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkricd
    kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
    skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcsagatvlriakdlaenn
    rgarvlvvcseitavtfrgpsdthldglvgaalfsdgaaalivgsdpdtsvgekpifemv
    saaqtilpdsdgaidghlrevglvfhllkdvpglisknivksldeafkplgisdwnslfw
    iahpggpaildqveiklglkeekmratrhvlseygnmssasvlfildemrrksakdgvat
    tgeglewgvlfgfgpgltvetvvlhsvpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dxeC (C:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkricdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcsagatvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldglvgaalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevglvfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssasvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxeC (C:)
    ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkricd
    kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
    skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcsagatvlriakdlaenn
    rgarvlvvcseitavtfrgpsdthldglvgaalfsdgaaalivgsdpdtsvgekpifemv
    saaqtilpdsdgaidghlrevglvfhllkdvpglisknivksldeafkplgisdwnslfw
    iahpggpaildqveiklglkeekmratrhvlseygnmssasvlfildemrrksakdgvat
    tgeglewgvlfgfgpgltvetvvlhsvpl