PDB entry 6dxb

View 6dxb on RCSB PDB site
Description: Crystal structure of chalcone synthase from Arabidopsis thaliana
Class: transferase
Keywords: Thiolase, Flavonoid, Polyketide synthase, TRANSFERASE
Deposited on 2018-06-28, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxba1, d6dxba2
  • Chain 'B':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxbb1, d6dxbb2
  • Chain 'C':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxbc1, d6dxbc2
  • Chain 'D':
    Compound: chalcone synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CHS, TT4, At5g13930, MAC12.11, MAC12.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxbd1, d6dxbd2
  • Heterogens: CSD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxbA (A:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkrmcdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxbA (A:)
    ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcd
    kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
    skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaenn
    rgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekpifemv
    saaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdwnslfw
    iahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksakdgvat
    tgeglewgvlfgfgpgltvetvvlhsvpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxbB (B:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkrmcdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxbB (B:)
    ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcd
    kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
    skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaenn
    rgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekpifemv
    saaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdwnslfw
    iahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksakdgvat
    tgeglewgvlfgfgpgltvetvvlhsvpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dxbC (C:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkrmcdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxbC (C:)
    sldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcdk
    stirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpks
    kithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaennr
    garvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekpifemvs
    aaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdwnslfwi
    ahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksakdgvatt
    geglewgvlfgfgpgltvetvvlhsvpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dxbD (D:)
    mvmagassldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkek
    fkrmcdkstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaik
    ewgqpkskithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriak
    dlaennrgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgek
    pifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisd
    wnslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksa
    kdgvattgeglewgvlfgfgpgltvetvvlhsvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxbD (D:)
    sldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcdk
    stirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpks
    kithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaennr
    garvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekpifemvs
    aaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdwnslfwi
    ahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksakdgvatt
    geglewgvlfgfgpgltvetvvlhsvpl