PDB entry 6dx7

View 6dx7 on RCSB PDB site
Description: Crystal structure of chalcone synthase from Physcomitrella patens
Class: transferase
Keywords: Thiolase, Flavonoid, Polyketide synthase, TRANSFERASE
Deposited on 2018-06-28, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7a1, d6dx7a2
  • Chain 'B':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7b1, d6dx7b2
  • Chain 'C':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7c1, d6dx7c2
  • Chain 'D':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7d1, d6dx7d2
  • Chain 'E':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7e1, d6dx7e2
  • Chain 'F':
    Compound: chalcone synthase
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPA_029015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx7f1, d6dx7f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dx7A (A:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7A (A:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dx7B (B:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7B (B:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dx7C (C:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7C (C:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dx7D (D:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7D (D:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dx7E (E:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7E (E:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dx7F (F:)
    masagdvtraalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealka
    kfkricdksgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkai
    kewggrksdithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrva
    kdlaennkgarvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
    plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
    wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
    kmgastlgegsefgffigfgpgltlevlvlraapnsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx7F (F:)
    raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk
    sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks
    dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk
    garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevekplfevhwa
    getilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspawnemfwav
    hpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsvkmgastlg
    egsefgffigfgpgltlevlvlraapn