PDB entry 6dwv

View 6dwv on RCSB PDB site
Description: Crystal structure of the LigJ Hydratase in the Apo state
Class: lyase
Keywords: Hydratase, lignin degradation, LYASE
Deposited on 2018-06-28, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwva_
  • Chain 'B':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwvb_
  • Chain 'C':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwvc_
  • Chain 'D':
    Compound: 4-oxalomesaconate hydratase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligJ, SLG_12520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwvd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dwvA (A:)
    mmmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlike
    rgadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspead
    mtssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvs
    gscnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrglad
    mlkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyf
    ddtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwvA (A:)
    miidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerg
    admtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmt
    ssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgs
    cnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladml
    kqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfdd
    tkryidaldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dwvB (B:)
    mmmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlike
    rgadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspead
    mtssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvs
    gscnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrglad
    mlkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyf
    ddtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwvB (B:)
    miidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerg
    admtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmt
    ssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgs
    cnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladml
    kqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfdd
    tkryidaldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dwvC (C:)
    mmmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlike
    rgadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspead
    mtssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvs
    gscnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrglad
    mlkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyf
    ddtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwvC (C:)
    miidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerg
    admtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmt
    ssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgs
    cnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladml
    kqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfdd
    tkryidaldisdqerhaifegntrrvfprldaklkargl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dwvD (D:)
    mmmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlike
    rgadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspead
    mtssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvs
    gscnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrglad
    mlkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyf
    ddtkryidaldisdqerhaifegntrrvfprldaklkargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwvD (D:)
    miidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerg
    admtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmt
    ssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgs
    cnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladml
    kqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfdd
    tkryidaldisdqerhaifegntrrvfprldaklkargl