PDB entry 6dwi

View 6dwi on RCSB PDB site
Description: Structure of the 4462 Antibody Fab fragment bound to a Staphylococcus aureus wall techoic acid analog
Class: immune system
Keywords: Antibody, Fab, wall teichoic acid, WTA, Staphylococcus aureus, IMMUNE SYSTEM
Deposited on 2018-06-26, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwia1, d6dwia2
  • Chain 'B':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'C':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwic1, d6dwic2
  • Chain 'D':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'E':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwie1, d6dwie2
  • Chain 'F':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'G':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwig1, d6dwig2
  • Chain 'H':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'I':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwii1, d6dwii2
  • Chain 'J':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'K':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwik1, d6dwik2
  • Chain 'L':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'M':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwim1, d6dwim2
  • Chain 'N':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Chain 'O':
    Compound: 4462 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
    Domains in SCOPe 2.07: d6dwio1, d6dwio2
  • Chain 'P':
    Compound: 4462 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWI
  • Heterogens: CL, HD4, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dwiA (A:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiA (A:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dwiC (C:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiC (C:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvlqsgnsqesvteqdskdstyslsstltlsk
    adyekvyacevthqglsspvtksfnr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dwiE (E:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiE (E:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkapmilvsgastrasgaparfs
    gsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqspvtksfnr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dwiG (G:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiG (G:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6dwiI (I:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiI (I:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6dwiK (K:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiK (K:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6dwiM (M:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiM (M:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdkdstyslsstltl
    skadyekhkvyacevthqpvtksfnrg
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6dwiO (O:)
    mgwsciilflvatatgvhsdiqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkag
    qapmilvsgastrasgaparfsgsgygteftltitslqsedfavyyclqyntwprtfgqg
    tkvevkrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqe
    svteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwiO (O:)
    diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
    rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'P':
    No sequence available.