PDB entry 6dwa

View 6dwa on RCSB PDB site
Description: Structure of the 4497 Antibody Fab fragment bound to a Staphylococcus aureus wall techoic acid analog
Class: immune system
Keywords: Antibody, Fab, wall teichoic acid, WTA, Staphylococcus aureus, IMMUNE SYSTEM
Deposited on 2018-06-26, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4497 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWA
    Domains in SCOPe 2.07: d6dwaa1, d6dwaa2
  • Chain 'B':
    Compound: 4497 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWA
  • Chain 'H':
    Compound: 4497 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWA
  • Chain 'L':
    Compound: 4497 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DWA (Start-238)
    Domains in SCOPe 2.07: d6dwal1, d6dwal2
  • Heterogens: HD4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dwaA (A:)
    mgwsciilflvatatgvhsdiqltqspdslavslgeratinckssqsifrtsrnknllnw
    yqqrpgqpprllihwastrksgvpdrfsgsgfgtdftltitslqaedvaiyycqqyfspp
    ytfgqgtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalq
    sgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwaA (A:)
    diqltqspdslavslgeratinckssqsifrtsrnknllnwyqqrpgqpprllihwastr
    ksgvpdrfsgsgfgtdftltitslqaedvaiyycqqyfsppytfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dwaL (L:)
    mgwsciilflvatatgvhsdiqltqspdslavslgeratinckssqsifrtsrnknllnw
    yqqrpgqpprllihwastrksgvpdrfsgsgfgtdftltitslqaedvaiyycqqyfspp
    ytfgqgtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalq
    sgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwaL (L:)
    iqltqspdslavslgeratinckssqsifrtsrnknllnwyqqrpgqpprllihwastrk
    sgvpdrfsgsgfgtdftltitslqaedvaiyycqqyfsppytfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec