PDB entry 6dw2

View 6dw2 on RCSB PDB site
Description: Structure of the 6078 Antibody Fab fragment bound to a Staphylococcus aureus wall techoic acid analog
Class: immune system
Keywords: Antibody, Fab, wall teichoic acid, WTA, Staphylococcus aureus, IMMUNE SYSTEM
Deposited on 2018-06-26, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6078 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DW2
    Domains in SCOPe 2.07: d6dw2a1, d6dw2a2
  • Chain 'B':
    Compound: 6078 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DW2
  • Heterogens: HD4, NA, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dw2A (A:)
    mkkniafllasmfvfsiatnayadivmtqspsilsasvgdrvtitcrasqtisgwlawyq
    qkpaeapklliykastlesgvpsrfsgsgsgteftltisslqpddfgiyycqqyksysfn
    fgqgtkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsg
    nsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dw2A (A:)
    divmtqspsilsasvgdrvtitcrasqtisgwlawyqqkpaeapklliykastlesgvps
    rfsgsgsgteftltisslqpddfgiyycqqyksysfnfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.