PDB entry 6dvs

View 6dvs on RCSB PDB site
Description: Crystal structure of Pseudomonas stutzeri D-phenylglycine aminotransferase
Class: transferase
Keywords: aminotransferase, TRANSFERASE
Deposited on 2018-06-25, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-phenylglycine aminotransferase
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: dpgA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dvsa_
  • Heterogens: SO4, EDO, TRS, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dvsA (A:)
    msilndykrktegsvfwaqrarsvmpdgvtadtrvfdphglfisdaqgvhktdvdgnvyl
    dffgghgalvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftg
    sgtettllalrvaraftgrrmilriathyhgwhdfsasgynshfdgqpapgvlpeiaknt
    llirpddiegmrevfaqhgsdiaafiaepvgshfgvtpvsdsflregaelarqygalfil
    devisgfrvgnhgmqalldvqpdltclakasagglpggilggredvmgvlsrgsdrkvlh
    qgtftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfarkglnwlaygrfsg
    fhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvflsaqhereh
    vehlvttfdrvldrladenllswqptnlsgnqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dvsA (A:)
    silndykrktegsvfwaqrarsvmpddphglfisdaqgvhktdvdgnvyldffgghgalv
    lghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgsgtettllal
    rvaraftgrrmilriathyakntllirpddiegmrevfaqhgsdiaafiaepvgshfgvt
    pvsdsflregaelarqygalfildevisgfrvgnhgmqalldvqpdltclakasagglpg
    gilggredvmgvlstftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfark
    glnwlaygrfsgfhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrg
    svflsaqherehvehlvttfdrvldrladenllswqp