PDB entry 6dux

View 6dux on RCSB PDB site
Description: 2.25 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Klebsiella pneumoniae in Complex with NAD.
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, 6-phospho-alpha-glucosidase, NAD, HYDROLASE
Deposited on 2018-06-22, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-alpha-glucosidase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGA6 (4-442)
      • expression tag (3)
    Domains in SCOPe 2.07: d6duxa1, d6duxa2, d6duxa3
  • Chain 'B':
    Compound: 6-phospho-alpha-glucosidase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: AGLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGA6 (4-442)
      • expression tag (3)
    Domains in SCOPe 2.07: d6duxb1, d6duxb2, d6duxb3
  • Heterogens: NAD, LMR, ACT, GOL, CL, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6duxA (A:)
    snamkkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilk
    eqapeiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggia
    ygmrsiggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakilnicdmpigieg
    rmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakygyvppsndpht
    easwndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhreknvfs
    acraiiaagkstagdleidehasyivdlataiafntqermllivpnngaihnfdadamve
    ipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsktvps
    asvakailddliaankdywpelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6duxA (A:)
    mkkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqa
    peiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygm
    rsiggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakilnicdmpigiegrma
    qivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakygyvppsaswndtfa
    kakdvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhreknvfsacraiiaag
    kstagdleidehasyivdlataiafntqermllivpnngaihnfdadamveipclvghng
    pepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsktvpsasvakaild
    dliaankdywpelh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6duxB (B:)
    snamkkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilk
    eqapeiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggia
    ygmrsiggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakilnicdmpigieg
    rmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakygyvppsndpht
    easwndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhreknvfs
    acraiiaagkstagdleidehasyivdlataiafntqermllivpnngaihnfdadamve
    ipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsktvps
    asvakailddliaankdywpelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6duxB (B:)
    mkkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqa
    peiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygm
    rsiggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakilnicdmpigiegrma
    qivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakygyvppsndtfakak
    dvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhreknvfsacraiiaagkst
    agdleidehasyivdlataiafntqermllivpnngaihnfdadamveipclvghngpep
    ltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsktvpsasvakailddli
    aankdywpelh