PDB entry 6dts

View 6dts on RCSB PDB site
Description: Maltotetraose bound T. maritima MalE2
Class: sugar binding protein
Keywords: periplasmic binding protein, maltose binding protein, maltotetraose, SUGAR BINDING PROTEIN
Deposited on 2018-06-18, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein MalE2
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_1839
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S5Y1 (Start-374)
      • expression tag (375-380)
    Domains in SCOPe 2.07: d6dtsa1, d6dtsa2
  • Chain 'B':
    Compound: maltose-binding protein MalE2
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_1839
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S5Y1 (Start-374)
      • expression tag (375-379)
    Domains in SCOPe 2.07: d6dtsb1, d6dtsb2
  • Heterogens: MTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtsA (A:)
    mqtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiiv
    gahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyv
    dsvpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvt
    diglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdag
    inygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladp
    rlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasved
    alkeavekikaqiekgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtsA (A:)
    tkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivga
    hdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvds
    vpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdi
    glanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagin
    ygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprl
    parkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedal
    keavekikaqiekgshhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dtsB (B:)
    mqtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiiv
    gahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyv
    dsvpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvt
    diglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdag
    inygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladp
    rlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasved
    alkeavekikaqiekgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtsB (B:)
    tkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivga
    hdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvds
    vpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdi
    glanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagin
    ygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprl
    parkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedal
    keavekikaqiekgshhh