PDB entry 6dsq

View 6dsq on RCSB PDB site
Description: Re-refinement of P. falciparum orotidine 5'-monophosphate decarboxylase
Class: lyase
Keywords: Complex, P falciparum, LYASE
Deposited on 2018-06-14, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dsqa_
  • Chain 'B':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dsqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dsqA (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dsqA (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfdyl
    yelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknkyy
    safvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgansy
    demnyirtyfpncyilspgidlhktltngyhksyekilinigraitknpypqkaaqmyyd
    qinailkqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dsqB (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dsqB (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfdyl
    yelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknkyy
    safvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgansy
    demnyirtyfpncyilspggdlhktltngyhksyekilinigraitknpypqkaaqmyyd
    qinailkqn