PDB entry 6drv

View 6drv on RCSB PDB site
Description: Beta-galactosidase
Class: hydrolase
Keywords: cryo-EM, Amazon Web Services, RELION, HYDROLASE
Deposited on 2018-06-13, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: EM
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6drvd1, d6drvd2, d6drvd3, d6drvd4, d6drvd5

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6drvD (D:)
    mtmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewr
    fawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenp
    tgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflra
    genrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsrav
    leaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpk
    lwsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrheh
    hplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethg
    mvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvd
    psrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceya
    hamgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndr
    qfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvald
    gkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqq
    wrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltp
    lrdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlitta
    hawqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlg
    lgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfni
    srysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlv
    wcqk