PDB entry 6dr9

View 6dr9 on RCSB PDB site
Description: Crystal Structure of the YopH PTP1B Chimera 3 PTPase apo form
Class: hydrolase
Keywords: PTPase, phosphatase, PTP, HYDROLASE, YopH
Deposited on 2018-06-11, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Targeted effector protein
    Species: Yersinia pestis [TaxId:632]
    Gene: yopH, YPCD1.67c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68720 (Start-305)
      • engineered mutation (72)
      • engineered mutation (189-190)
      • engineered mutation (196)
      • conflict (229)
    Domains in SCOPe 2.07: d6dr9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dr9A (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvttwpdfgvvssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dr9A (A:)
    pygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnan
    yiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgt
    ygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvttwpvvssevtkalas
    lvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsqlsve
    dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns