PDB entry 6dq0

View 6dq0 on RCSB PDB site
Description: sfGFP D133 mutated to 4-nitro-L-phenylalanine
Class: fluorescent protein
Keywords: super folder GFP, 4-nitro-L-phenylalanine, unnatural amino acid, FLUORESCENT PROTEIN
Deposited on 2018-06-10, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superfolder green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DQ0
    Domains in SCOPe 2.07: d6dq0a_
  • Chain 'B':
    Compound: superfolder green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DQ0
    Domains in SCOPe 2.07: d6dq0b_
  • Heterogens: EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dq0A (A:)
    mvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwpt
    lvttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtl
    vnrielkgidfkefgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqla
    dhyqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dq0A (A:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkefgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dq0B (B:)
    mvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwpt
    lvttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtl
    vnrielkgidfkefgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqla
    dhyqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dq0B (B:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkefgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith