PDB entry 6dps

View 6dps on RCSB PDB site
Description: Crystal Structure of Neisseria meningitidis DsbD n-terminal domain in the oxidised form
Class: oxidoreductase
Keywords: disulphide reductase, Dsb proteins, OXIDOREDUCTASE
Deposited on 2018-06-09, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6 (Start-125)
      • engineered mutation (102)
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6 (Start-125)
      • engineered mutation (102)
  • Chain 'C':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6 (Start-125)
      • engineered mutation (102)
  • Chain 'D':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6 (2-125)
      • engineered mutation (102)
  • Chain 'E':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6
      • engineered mutation (102)
  • Chain 'F':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis (strain alpha14) [TaxId:662598]
    Gene: dsbD, NMO_1340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S7X6
      • engineered mutation (102)
    Domains in SCOPe 2.07: d6dpsf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dpsF (F:)
    snandllppekafvpelavaddgvnvrfriadgyymyqakivgktdpadllgqpsfskge
    ekedeffgrqtvyhheaqvafpyakavgepyklvltyqgcaevgvcyppvdtefdisgng
    tyhpqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dpsF (F:)
    dllppekafvpelavaddgvnvrfriadgyymyqakivgktdpadllgqpsfskgeeked
    effgrqtvyhheaqvafpyakavgepyklvltyqgcaevgvcyppvdtefdisgngtyhp