PDB entry 6do0

View 6do0 on RCSB PDB site
Description: Crystal structure of the multidrug binding transcriptional regulator LmrR in complex with Rhodium Bis-diphosphine Complex
Class: metal binding protein
Keywords: protein scaffold, rhodium bis-diphosphine complex, CO2 hydrogenation, METAL BINDING PROTEIN
Deposited on 2018-06-08, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris (strain MG1363) [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2RI36
      • engineered mutation (55)
      • engineered mutation (59)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6do0a_
  • Chain 'B':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris (strain MG1363) [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2RI36 (2-End)
      • expression tag (0-1)
      • engineered mutation (55)
      • engineered mutation (59)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6do0b1, d6do0b2
  • Heterogens: JY1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6do0A (A:)
    mgaeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifdrleq
    dgiissywgdesqggrrkyyrlteighencrlafeswsrvdkiienleankkseaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6do0A (A:)
    pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifdrleqdgiis
    sywgrrkyyrlteighencrlafeswsrvdkiienleank
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6do0B (B:)
    mgaeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifdrleq
    dgiissywgdesqggrrkyyrlteighencrlafeswsrvdkiienleankkseaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6do0B (B:)
    mgaeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifdrleq
    dgiissywgggrrkyyrlteighencrlafeswsrvdkiienleank