PDB entry 6dnb

View 6dnb on RCSB PDB site
Description: Crystal structure of T110A:S256A mutant human Glutamate oxaloacetate transaminase 1 (GOT1)
Class: transferase
Keywords: Aspartate aminotransferase, Glutamate oxaloacetate transaminase 1, GOT1, PLP, TRANSFERASE
Deposited on 2018-06-06, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174 (0-410)
      • engineered mutation (107)
      • engineered mutation (253)
      • conflict (349)
    Domains in SCOPe 2.07: d6dnba_
  • Heterogens: PG4, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dnbA (A:)
    ppsvfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkia
    ndnslnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflar
    wyngtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenap
    efsivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawair
    yfvsegfeffcaqafsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaq
    garivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwihitdqigmfs
    ftglnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq