PDB entry 6dna

View 6dna on RCSB PDB site
Description: Crystal structure of T110A mutant human Glutamate oxaloacetate transaminase 1 (GOT1)
Class: transferase
Keywords: Aspartate aminotransferase, Glutamate oxaloacetate transaminase 1, GOT1, PLP, TRANSFERASE
Deposited on 2018-06-06, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174 (Start-404)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnaa_
  • Chain 'B':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174 (Start-404)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnab_
  • Chain 'C':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnac_
  • Chain 'D':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174 (Start-404)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnad_
  • Chain 'E':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnae_
  • Chain 'F':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17174
      • engineered mutation (104)
    Domains in SCOPe 2.07: d6dnaf_
  • Heterogens: PG4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dnaA (A:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaA (A:)
    vlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylpil
    glaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkntpvy
    vssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhacahn
    ptgidptpeqwkqiasvmkhrflfpffdsayqgfsgnlerdawairyfvsegfeffcaqs
    fsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsnpel
    feewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqveylhi
    yllpsgrinvsglttknldyvatsiheavt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dnaB (B:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaB (B:)
    pvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylpi
    lglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkntpv
    yvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhacah
    nptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeffca
    qsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsnp
    elfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftgnpkqveylv
    nekhiyllpsgrinvsglttknldyvatsiheavt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dnaC (C:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaC (C:)
    qaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnhey
    lpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkn
    tpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlha
    cahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfef
    fcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastl
    snpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqv
    eylvnekhillpsgrinvsglttknldyvat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dnaD (D:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaD (D:)
    qpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylp
    ilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkntp
    vyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhaca
    hnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeffc
    aqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsn
    pelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqvey
    lnekhiyllpsgrinvsglttknldyvatsiheavt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dnaE (E:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaE (E:)
    lvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylpilg
    laefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkntpvyv
    ssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhacahnp
    tgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeffcaqs
    fsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsnpel
    feewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqveylvn
    ekhiyllpsgrinvsglttknldyvatsiheav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dnaF (F:)
    vfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandn
    slnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyn
    gtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefs
    ivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfv
    segfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgar
    ivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftg
    lnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnaF (F:)
    vlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylpil
    glaefrscasrlalgddspalkekrvggvqslggagalrigadflarwyngtnnkntpvy
    vssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhacahn
    ptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeffcaq
    sfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsnpe
    lfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqveylv
    nekhillpsgrinvsglttknld