PDB entry 6dmx

View 6dmx on RCSB PDB site
Description: HBZ56 in complex with KIX and c-Myb
Class: transcription
Keywords: transcription coactivator, transcription factor, viral, eukaryotic, complex, TRANSCRIPTION
Deposited on 2018-06-05, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dmxb_
  • Chain 'C':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dmxd_
  • Chain 'E':
    Compound: BZIP factor
    Species: Human T-lymphotropic virus 1 [TaxId:11908]
    Gene: HBZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2Q067 (Start-57)
      • engineered mutation (15)
  • Chain 'F':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dmxg_
  • Chain 'H':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dmxi_
  • Chain 'J':
    Compound: BZIP factor
    Species: Human T-lymphotropic virus 1 [TaxId:11908]
    Gene: HBZ
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dmxB (B:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dmxB (B:)
    kgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrde
    yyhllaekiykiqkeleekrrsrl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dmxD (D:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dmxD (D:)
    whehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrdeyy
    hllaekiykiqkeleekrrsr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dmxG (G:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dmxG (G:)
    rkgwhehvtqdlrshlvhklvqaifpdpaalkdrrmenlvayakkvegdmyesansrdey
    yhllaekiykiqkeleekrrsrl
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6dmxI (I:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dmxI (I:)
    whehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrdeyy
    hllaekiykiqkeleekrrsr
    

  • Chain 'J':
    No sequence available.