PDB entry 6dlk

View 6dlk on RCSB PDB site
Description: Crystal structure of DNA polymerase III subunit beta from Rickettsia rickettsii
Class: transferase
Keywords: SSGCID, DnaN, DNA polymerase III beta, potential drug target, sliding clamp, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2018-06-01, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta sliding clamp
    Species: Rickettsia rickettsii (strain Sheila Smith) [TaxId:392021]
    Gene: A1G_03290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dlka1, d6dlka2, d6dlka3, d6dlka4
  • Chain 'B':
    Compound: Beta sliding clamp
    Species: Rickettsia rickettsii (strain Sheila Smith) [TaxId:392021]
    Gene: A1G_03290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dlkb1, d6dlkb2, d6dlkb3, d6dlkb4
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dlkA (A:)
    mahhhhhhmlklivetktlvqslgfassvvekrnvipeyaniklsaqdgnlelsstnmdl
    ylsqkiavqvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlp
    vssfpamdsinpeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsast
    dghrlsiswvtlekqiknfgvilpqksaeeilkivkdpkninedieillnsnkikficne
    ntimlsklidgtfpdystfipessssklvinrkmfadsieriaiitvekfravklslsre
    tleisavgeargnakevinssqdkesfyeynsdeslaigfnpqyledvlkavksdlvely
    fsdvsapvlikfpenpkdifvvmpvkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dlkA (A:)
    hmlklivetktlvqslgfassvvekrnvipeyaniklsaqdgnlelsstnmdlylsqkia
    vqvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlpvssfpam
    dsinpeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsastdghrlsi
    swvtlekqiknfgvilpqksaeeilkivkdpkninedieillnsnkikficnentimlsk
    lidgtfpdystfipessssklvinrkmfadsieriaiitvekfravklslsretleisav
    geargnakevinssqdkesfyeynsdeslaigfnpqyledvlkavksdlvelyfsdvsap
    vlikfpenpkdifvvmpvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dlkB (B:)
    mahhhhhhmlklivetktlvqslgfassvvekrnvipeyaniklsaqdgnlelsstnmdl
    ylsqkiavqvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlp
    vssfpamdsinpeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsast
    dghrlsiswvtlekqiknfgvilpqksaeeilkivkdpkninedieillnsnkikficne
    ntimlsklidgtfpdystfipessssklvinrkmfadsieriaiitvekfravklslsre
    tleisavgeargnakevinssqdkesfyeynsdeslaigfnpqyledvlkavksdlvely
    fsdvsapvlikfpenpkdifvvmpvkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dlkB (B:)
    hmlklivetktlvqslgfassvvipeyaniklsaqdgnlelsstnmdlylsqkiavqvvs
    egectvstktlndivrklpdseltltdlgttgleikgknckfnlftlpvssfpamdsinp
    easfkisctdfakiiestkfsisldetrynlngvylhikdkefcsastdghrlsiswvtl
    ekqiknfgvilpqksaeeilkivkdpkninedieillnsnkikficnentimlsklidgt
    fpdystfipessssklvinrkmfadsieriaiitvekfravklslsretleisavgearg
    nakevinssqdkesfyeynsdeslaigfnpqyledvlkavksdlvelyfsdvsapvlikf
    penpkdifvvmpvkv