PDB entry 6dkt

View 6dkt on RCSB PDB site
Description: Crystal structure of Arginase from Bacillus subtilis
Class: metal binding protein
Keywords: Manganese, METAL BINDING PROTEIN
Deposited on 2018-05-30, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dkta_
  • Chain 'B':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dktb_
  • Chain 'C':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dktc_
  • Chain 'D':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dktd_
  • Chain 'E':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dkte_
  • Chain 'F':
    Compound: arginase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rocF, BSU40320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dktf_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dktA (A:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktA (A:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinnlnsvlagn
    eklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlntletsps
    gnihgmplavslgigheslvnlegyapkikpenvviigarsldegerkyikesgmkvytm
    heidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlame
    mlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dktB (B:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktB (B:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinnlnsvlagn
    eklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlntletsps
    gnihgmplavslgigheslvnlegyapkikpenvviigarsldegerkyikesgmkvytm
    heidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlame
    mlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dktC (C:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktC (C:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinnlnsvlagn
    eklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlntletsps
    gnihgmplavslgigheslvnlegyapkikpenvviigarsldegerkyikesgmkvytm
    heidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlame
    mlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dktD (D:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktD (D:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinnlnsvlagn
    eklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlntletsps
    gnihgmplavslgigheslvnlegyapkikpenvviigarsldegerkyikesgmkvytm
    heidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlame
    mlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dktE (E:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktE (E:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinsvlagnekl
    aqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlnmplavslgig
    heslvnlegyapkikpenvviigarsldegerkyikesgmkvytmheidrlgmtkvieet
    ldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlamemlydagiitsaefve
    vnpildhknktgktavelvesllgkkll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dktF (F:)
    mdktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinrekiknd
    eelknlnsvlagneklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwyd
    ahgdlntletspsgnihgmplavslgigheslvnlegyapkikpenvviigarsldeger
    kyikesgmkvytmheidrlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvv
    ggisyreshlamemlydagiitsaefvevnpildhknktgktavelvesllgkkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dktF (F:)
    ktisvigmpmdlgqarrgvdmgpsairyahlierlsdmgytvedlgdipinnlnsvlagn
    eklaqkvnkvieekkfplvlggdhsiaigtlagtakhydnlgviwydahgdlntlesgni
    hgmplavslgigheslvnlegyapkikpenvviigarsldegerkyikesgmkvytmhei
    drlgmtkvieetldylsacdgvhlsldldgldpndapgvgtpvvggisyreshlamemly
    dagiitsaefvevnpildhknktgktavelvesllgkkll