PDB entry 6dk4

View 6dk4 on RCSB PDB site
Description: Crystal structure of Campylobacter jejuni peroxide stress regulator
Class: metal transport
Keywords: PerR, ferric uptake regulator, Campylobacter jejuni, Peroxide stress, METAL TRANSPORT
Deposited on 2018-05-28, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: perR, fur, Cj0322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dk4a_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: perR, fur, Cj0322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dk4b_
  • Heterogens: MN, ZN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dk4A (A:)
    mellqmlkkhelkatpqrlcvlkilkrhehpnidelyieikkeypsislatvyknlntlq
    eqglvveinvlnqktcydiyeeehihvvctkcggiedlsfkdaklyeyqehlekkignlv
    nhlsvcayvdnckkchenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dk4A (A:)
    mellqmlkkhelkatpqrlcvlkilkrhehpnidelyieikkeypsislatvyknlntlq
    eqglvveinvlnqktcydiyeeehihvvctkcggiedlsfkdaklyeyqehlekkignlv
    nhlsvcayvdnckkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dk4B (B:)
    mellqmlkkhelkatpqrlcvlkilkrhehpnidelyieikkeypsislatvyknlntlq
    eqglvveinvlnqktcydiyeeehihvvctkcggiedlsfkdaklyeyqehlekkignlv
    nhlsvcayvdnckkchenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dk4B (B:)
    lcvlkilkrhehpnidelyieikkeyslatvyknlntlqeqglvveinvlqktcydiyee
    ehihvvctkcggiedlsfkdaklyeyqehlekkignlvnhlsvcayvdnckkc