PDB entry 6djl

View 6djl on RCSB PDB site
Description: Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A
Class: signaling protein/protein transport
Keywords: Rab GTPase, Guanine nucleotide exchange factor, membrane trafficking, PROTEIN TRANSPORT, SIGNALING PROTEIN-PROTEIN TRANSPORT complex
Deposited on 2018-05-25, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.07: d6djla_
  • Chain 'B':
    Compound: SH3 domain-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3BP5, SAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: SH3 domain-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3BP5, SAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: SH3 domain-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3BP5, SAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: SH3 domain-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3BP5, SAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.07: d6djlf_
  • Chain 'G':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.07: d6djlg_
  • Chain 'H':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.07: d6djlh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6djlA (A:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6djlA (A:)
    ddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqi
    wdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgn
    lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqmsd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6djlF (F:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6djlF (F:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6djlG (G:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6djlG (G:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnh
    lravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6djlH (H:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6djlH (H:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms