PDB entry 6dig

View 6dig on RCSB PDB site
Description: Crystal structure of DQ6 in complex with a neuro-peptide
Class: immune system
Keywords: MHC Class II HLA, IMMUNE SYSTEM
Deposited on 2018-05-23, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6diga1, d6diga2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6digb1, d6digb2
  • Chain 'C':
    Compound: 13-mer peptide: ALA-GLY-ASN-HIS-ALA-ALA-GLY-ILE-LEU-THR-LEU-GLY-LYS
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DIG (0-12)
  • Heterogens: NAG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6digA (A:)
    edivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpq
    galrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkh
    wepeipapmseltetvggggslevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6digA (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6digB (B:)
    gsggggspedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrp
    daeywnsqkevlegtraeldtvcrhnyevafrgilqrrveptvtispsrtealnhhnllv
    csvtdfypgqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchve
    hpslqspitvewraqsesaqskgtggggslevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6digB (B:)
    spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
    sqkevlegtraeldtvcrhnyevafrgilqrrveptvtispsnllvcsvtdfypgqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    

  • Chain 'C':
    No sequence available.