PDB entry 6dhb

View 6dhb on RCSB PDB site
Description: Crystal structure of the human TIM-3 with bound Calcium
Class: immune system
Keywords: T Cell Immunoglobulin Mucin-3 Immunological tolerance, IMMUNE SYSTEM
Deposited on 2018-05-19, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatitis A virus cellular receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HAVCR2, TIM3, TIMD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TDQ0 (1-107)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6dhba_
  • Heterogens: CA, BEZ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhbA (A:)
    mveyraevgqnaylpcfytpaapgnlvpvcwgkgacpvfecgnvvlrtderdvnywtsry
    wlngdfrkgdvsltienvtladsgiyccriqipgimndekfnlklvik