PDB entry 6dgk

View 6dgk on RCSB PDB site
Description: Crystal Structure of the Non-Structural Protein 1 (NS1) effector domain W187A mutant from the A/Brevig Mission/1/1918 (H1N1) strain of Influenza A Virus
Class: viral protein
Keywords: Influenza, NS1, effector domain, W187A, VIRAL PROTEIN
Deposited on 2018-05-17, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-structural protein 1
  Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
  Gene: NS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99AU3 (0-119)
    • engineered mutation (101)
  Domains in SCOPe 2.08: d6dgka_
• Chain 'B':
  Compound: Non-structural protein 1
  Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
  Gene: NS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99AU3 (0-119)
    • engineered mutation (101)
  Domains in SCOPe 2.08: d6dgkb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6dgkA (A:)
  asryltdmtleemsrdwfmlmpkqkvagslcirmdqaimdkniilkanfsvifdrletli
  llrafteegaivgeisplpslpghtdedvknavgvliggleandntvrvsetlqrfawrs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6dgkB (B:)
  asryltdmtleemsrdwfmlmpkqkvagslcirmdqaimdkniilkanfsvifdrletli
  llrafteegaivgeisplpslpghtdedvknavgvliggleandntvrvsetlqrfawrs