PDB entry 6dgi

View 6dgi on RCSB PDB site
Description: The crystal structure of D-alanyl-alanine synthetase A from Vibrio cholerae O1 biovar eltor str. N16961
Class: ligase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-05-17, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ddl, VC_A0572
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KM17 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6dgia1, d6dgia2, d6dgia3
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ddl, VC_A0572
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgib1, d6dgib2
  • Heterogens: GOL, ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dgiA (A:)
    snamtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalv
    yldtnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansfnk
    itsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvtte
    dqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysyeek
    ysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevnt
    fpgmtpismfpkmlehnghrfseflvqcvtntlvnak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgiA (A:)
    amtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalvyl
    dtnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansfnkit
    sklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvttedq
    iapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysyeekys
    anshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevntfp
    gmtpismfpkmlehnghrfseflvqcvtntlvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dgiB (B:)
    snamtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalv
    yldtnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansfnk
    itsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvtte
    dqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysyeek
    ysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevnt
    fpgmtpismfpkmlehnghrfseflvqcvtntlvnak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgiB (B:)
    mtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalvyld
    tnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansfnkits
    klwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvttedqi
    apaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysyeekysr
    tvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevntfpgmtpis
    mfpkmlehnghrfseflvqcvtntlvna