PDB entry 6dg1

View 6dg1 on RCSB PDB site
Description: NMR structure of the second qRRM2 domain of human hnRNP H
Class: RNA binding protein
Keywords: hnRNP H, Heterogeneous nuclear ribonucleoprotein H, HqRRM2, qRRM2, RNA BINDING PROTEIN
Deposited on 2018-05-16, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: qRRM2 domain of Heterogeneous nuclear ribonucleoprotein H2
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPH2, FTP3, HNRPH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55795 (4-104)
      • expression tag (0-3)
      • conflict (51)
    Domains in SCOPe 2.07: d6dg1a1, d6dg1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dg1A (A:)
    snamdwvlkhtgpnspdtandgfvrlrglpfgcskeeivqffsgleivpngitlpvdfqg
    rstgeafvqfasqeiaekalkkhkerighryieifkssraevrth