PDB entry 6dfr

View 6dfr on RCSB PDB site
Description: crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state
Class: oxidoreductase
Keywords: oxido-reductase, oxidoreductase
Deposited on 1988-10-21, released 1990-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.08: d6dfra_
  • Heterogens: CA, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6dfrA (A:)
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

    Sequence, based on observed residues (ATOM records): (download) 
    >6dfrA (A:)
misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
pdyepddwesvfsefhdadaqnshsycfeilerr