PDB entry 6dfi

View 6dfi on RCSB PDB site
Description: Crystal structure of anti-Zika antibody Z021 bound to Zika virus envelope protein DIII
Class: immune system
Keywords: antibody, Fab, Zika, Dengue, recurrent, neutralizing, immune system
Deposited on 2018-05-14, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Zika virus envelope protein DIII
    Species: Zika virus [TaxId:64320]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfie_
  • Chain 'H':
    Compound: anti-Zika antibody Z021, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFI (0-End)
  • Chain 'L':
    Compound: anti-Zika antibody Z021, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFI (0-End)
    Domains in SCOPe 2.07: d6dfil1, d6dfil2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dfiE (E:)
    mrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgr
    litanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfiE (E:)
    vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
    pvitestenskmmleldppfgdsyivigvgekkithhwhrsg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dfiL (L:)
    eivltqspatlslspgqratlscrasqsvsnyfawyqqkpgqaprlliydtskratgtpa
    rfsgsgsgtdftltisslepedfavyycqernnwpltwtfglgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfiL (L:)
    eivltqspatlslspgqratlscrasqsvsnyfawyqqkpgqaprlliydtskratgtpa
    rfsgsgsgtdftltisslepedfavyycqernnwpltwtfglgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge