PDB entry 6ddv

View 6ddv on RCSB PDB site
Description: Crystal Structure Analysis of the Epitope of an Anti-MICA Antibody
Class: immune system
Keywords: Fab fragment-antigen complex, immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2018-05-10, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-MICA Fab fragment light chain clone 6E1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDV (0-End)
    Domains in SCOPe 2.07: d6ddva1, d6ddva2
  • Chain 'B':
    Compound: Anti-MICA Fab fragment heavy chain clone 6E1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDV
  • Chain 'C':
    Compound: MHC class I chain-related protein a
    Species: Homo sapiens [TaxId:9606]
    Gene: MICA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H9CTV0 (0-93)
      • engineered mutation (69)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ddvA (A:)
    dvlmtqtplslpvslgdqasiscrssqhivhsnentylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddvA (A:)
    dvlmtqtplslpvslgdqasiscrssqhivhsnentylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.