PDB entry 6dc7

View 6dc7 on RCSB PDB site
Description: Apo Fab structure of mouse monoclonal antibody 8B2
Class: immune system
Keywords: monoclonal antibody, fab, tau, phosphorylation state -specific antibody, IMMUNE SYSTEM
Deposited on 2018-05-04, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC7 (0-216)
  • Chain 'I':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC7 (0-216)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC7 (0-217)
    Domains in SCOPe 2.07: d6dc7l1, d6dc7l2
  • Chain 'M':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC7 (0-217)
    Domains in SCOPe 2.07: d6dc7m1, d6dc7m2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dc7L (L:)
    dvlltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspelliykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgvyycfqdshipytfgggtrleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dc7M (M:)
    dvlltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspelliykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgvyycfqdshipytfgggtrleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne