PDB entry 6dbp

View 6dbp on RCSB PDB site
Description: RNA-recognition motif 1 of human MSI2
Class: RNA binding protein
Keywords: musashi2 RNA recognition motif, RNA binding protein
Deposited on 2018-05-03, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Musashi homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MSI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96DH6 (1-83)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6dbpa_
  • Chain 'B':
    Compound: RNA-binding protein Musashi homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MSI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96DH6 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6dbpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dbpA (A:)
    mkmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlg
    qphheldsktidpkvafprraqpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbpB (B:)
    mkmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlg
    qphheldsktidpkvafprraqpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbpB (B:)
    mkmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlg
    qphheldsktidpkvafprraq