PDB entry 6dbg

View 6dbg on RCSB PDB site
Description: Crystal Structure of VHH R303 in complex with InlB-LRR-IR
Class: immune system
Keywords: nanobody VHH Listeria Internalin B, IMMUNE SYSTEM
Deposited on 2018-05-03, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: inlB, lmo0434
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dbga1, d6dbga2
  • Chain 'B':
    Compound: internalin b
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: inlB, lmo0434
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dbgb1, d6dbgb2
  • Chain 'C':
    Compound: vhh r303
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBG
    Domains in SCOPe 2.07: d6dbgc_
  • Chain 'D':
    Compound: vhh r303
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBG
    Domains in SCOPe 2.07: d6dbgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbgA (A:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplkenlyfqghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbgA (A:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbgB (B:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplkenlyfqghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbgB (B:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dbgC (C:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbgC (C:)
    vkleesgggsvqaggslrlscaasghtystycmgwfrqeregvarinvggsstwyadsvr
    drftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dbgD (D:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbgD (D:)
    vkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwya
    dsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtv
    ss