PDB entry 6dba

View 6dba on RCSB PDB site
Description: Crystal Structure of VHH R303
Class: immune system
Keywords: nanobody VHH Listeria, IMMUNE SYSTEM
Deposited on 2018-05-02, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody VHH R303
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBA (0-End)
    Domains in SCOPe 2.07: d6dbaa_
  • Chain 'B':
    Compound: nanobody VHH R303
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBA (0-End)
    Domains in SCOPe 2.07: d6dbab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbaA (A:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbaA (A:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbaB (B:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbaB (B:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vss