PDB entry 6db4

View 6db4 on RCSB PDB site
Description: JAK3 with Cyanamide CP34
Class: transferase/inhibitor
Keywords: kinase, covalent, TRANSFERASE-INHIBITOR complex
Deposited on 2018-05-02, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK3
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52333
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6db4a_
  • Heterogens: G4Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6db4A (A:)
    mghhhhhhqdptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpd
    qqrdfqreiqilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarlda
    srlllyssqickgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvv
    repgqspifwyapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgcerd
    vpalsrllelleegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr
    gcethaftahpegkhhslsfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6db4A (A:)
    ptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqgpdqqrdfqreiqil
    kalhsdfivkyrgvsyslrlvmeylpsgclrdflqrhrarldasrlllyssqickgmeyl
    gsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifwyapesls
    dnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmdvpalsrllelleegqrlpapp
    acpaevhelmklcwapspqdrpsfsalgpqldmlws