PDB entry 6dad

View 6dad on RCSB PDB site
Description: 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex
Class: calcium binding protein/membrane protein
Keywords: calmodulin, mutant, complex, CALCIUM BINDING PROTEIN-MEMBRANE PROTEIN complex
Deposited on 2018-05-01, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DP23
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6dada_
  • Chain 'B':
    Compound: Calmodulin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DP23
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6dadb_
  • Chain 'C':
    Compound: Voltage-dependent L-type calcium channel subunit alpha-1C
    Species: Homo sapiens [TaxId:9606]
    Gene: CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Voltage-dependent L-type calcium channel subunit alpha-1C
    Species: Homo sapiens [TaxId:9606]
    Gene: CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dadA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgigyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dadA (A:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgigyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dadB (B:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgigyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dadB (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgigyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.