PDB entry 6dac

View 6dac on RCSB PDB site
Description: Human CYP3A4 bound to an inhibitor
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2018-05-01, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6daca_
  • Heterogens: HEM, FZV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dacA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dacA (A:)
    thshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitd
    pdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemv
    piiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfven
    tkkldfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdflql
    midsqnskalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlp
    nkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsya
    lhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvl
    qnfsfkpcketqiplklslggllqpekpvvlkvesr