PDB entry 6d9n

View 6d9n on RCSB PDB site
Description: Crystal structure of an organic hydroperoxide resistance protein from Elizabethkingia anophelis with crystallant-derived thiocyanate bound
Class: oxidoreductase
Keywords: OPR1, thiocyanate, disulfide, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2018-04-30, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9na_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
    Gene: BD94_1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9nb1, d6d9nb2
  • Heterogens: SCN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d9nA (A:)
    mahhhhhhmktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaa
    gysacfdsalnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqd
    liekahqvcpysnatrgnievkltvsnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9nA (A:)
    mktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaagysacfds
    alnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqdliekahqv
    cpysnatrgnievkltvsnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d9nB (B:)
    mahhhhhhmktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaa
    gysacfdsalnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqd
    liekahqvcpysnatrgnievkltvsnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9nB (B:)
    hhhmktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaagysac
    fdsalnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqdlieka
    hqvcpysnatrgnievkltvsnn